SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018088 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018088
Domain Number 1 Region: 131-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.88e-70
Family Nuclear receptor ligand-binding domain 0.000000582
Further Details:      
 
Domain Number 2 Region: 33-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-26
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018088   Gene: ENSONIG00000014385   Transcript: ENSONIT00000018103
Sequence length 441
Comment pep:known_by_projection scaffold:Orenil1.0:GL831258.1:1819122:1829483:1 gene:ENSONIG00000014385 transcript:ENSONIT00000018103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEKATGVQIISEVLARQNKGDEEEKLTDDEEPRVCGVCGDLANGYHFNALTCEGCKGFF
RRTIKRSNQLRCPFLNKCVITKNSRRSCQACRMRKCQAIGMCKDMVMSDEKVLERRVKIK
KKKILNTPVQLSSQQERLIQELLFGHRSTFDSAFSRFSGFRPMDRNILPVNTHKQTASKL
FNPLTECPRNACSTASKSTTEPTSSPSATSCCLSSSRFHSSIKKQEHHIRNDVENRCVFT
ALPHVADLTTYMIQDVISFSKSLQDFQSLTMGDQISLLKGAMFEIIQIRFNMVFNSKTST
WECGHITYCIDDAVRAGFQPLLLEPLFRFHHTLRTLGLQEEEYVLMQAMSLFSPDRPGVQ
QHSLIDKVHENLALTLKTWIDCKRSGPEKHLLYPKVIACFTEMRTMTEEYSKQILQIQDI
QPDTITPLIMEVISKSSSNDL
Download sequence
Identical sequences I3KAE3
XP_005457927.1.78416 ENSONIP00000018088 ENSONIP00000018088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]