SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018089 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018089
Domain Number 1 Region: 131-425
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.22e-71
Family Nuclear receptor ligand-binding domain 0.000000535
Further Details:      
 
Domain Number 2 Region: 33-118
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-26
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018089   Gene: ENSONIG00000014385   Transcript: ENSONIT00000018104
Sequence length 433
Comment pep:known_by_projection scaffold:Orenil1.0:GL831258.1:1820293:1828283:1 gene:ENSONIG00000014385 transcript:ENSONIT00000018104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEKATGVQIISEVLARQNKGDEEEKLTDDEEPRVCGVCGDLANGYHFNALTCEGCKGFF
RRTIKRSNQLRCPFLNKCVITKNSRRSCQACRMRKCQAIGMCKDMVMSDEKVLERRVKIK
KKKILNTPVQLSSQQERLIQELLFGHRSTFDSAFSRFSGFRPMDRNILPVNTHKQTAKCP
RNACSTASKSTTEPTSSPSATSCCLSSSRFHSSIKKQEHHIRNDVENRCVFTALPHVADL
TTYMIQDVISFSKSLQDFQSLTMGDQISLLKGAMFEIIQIRFNMVFNSKTSTWECGHITY
CIDDAVRAGFQPLLLEPLFRFHHTLRTLGLQEEEYVLMQAMSLFSPDRPGVQQHSLIDKV
HENLALTLKTWIDCKRSGPEKHLLYPKVIACFTEMRTMTEEYSKQILQIQDIQPDTITPL
IMEVISKSSSNDL
Download sequence
Identical sequences I3KAE4
ENSONIP00000018089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]