SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018228 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018228
Domain Number 1 Region: 126-371
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-63
Family Nuclear receptor ligand-binding domain 0.0000000286
Further Details:      
 
Domain Number 2 Region: 58-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-30
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018228   Gene: ENSONIG00000014490   Transcript: ENSONIT00000018245
Sequence length 463
Comment pep:known_by_projection scaffold:Orenil1.0:GL831157.1:3940308:3952661:1 gene:ENSONIG00000014490 transcript:ENSONIT00000018245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRLSKTLLDMEVANYCEGLDPSYNTLGFEHAEVLYVGRGAPDSMPTEPSLPGPDGIISNC
AICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYTCRFSRQCVVDKDKRNQCRFCRLNKC
FRAGMKKEAVQNERDRISSRRSISDSQDLPTITILAQAESLSHQSTTPGGIADLSEQKSA
TVGDICDSMKQQLLVLVEWAKYIPTFGELPLDDQVSLLRAHAGEHLLLGVAKRSMPFKDF
LLLGNGCVIHRDSPEPEICRVANRVLDELVQPFQDIQIDDNEFAALKAIVFFDPDAKSLR
DPSKIKTMRLQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKFCGL
AKIDNLLHEMLLGGLTTEPTHLHHSAHTQLAQDPVTGHTLVISTMPVNHTPQIVNTQKKC
MQSSSPDTPIPSPPQGPAPEMYKHFPQPVCPPASPSPSAQTDP
Download sequence
Identical sequences I3KAT3
ENSONIP00000018228 ENSONIP00000018228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]