SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018478 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018478
Domain Number 1 Region: 258-484
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-63
Family Nuclear receptor ligand-binding domain 0.0000000286
Further Details:      
 
Domain Number 2 Region: 135-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-27
Family Nuclear receptor 0.0000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018478   Gene: ENSONIG00000014678   Transcript: ENSONIT00000018495
Sequence length 485
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:2319868:2331662:1 gene:ENSONIG00000014678 transcript:ENSONIT00000018495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEWMGPDINVVGPLQLPPNDEFSILESSHFYDILTDQGSPLLQDPDILPFTSYPSMQYQ
FMEPTVSSTPYYSTQNYYPQYNGDEWYSHTGIYELRKGPLEGSYEVEMEEGSSVVPAACK
RSRHLSQAGRVKGEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKSGGNCE
MDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNTKASPGQSTGDETEGPENV
DNKQVTSTTRLSKEKVELTKEQQALMKLIVDAYNKHQIPQDFAKKLLQEQYSADENFLLL
TEVATSQVQVLVEFTKSIPGFLSLDHEDQIALLKGSAVEATYLRSAQVFSKKMPTGYAQL
LEERIRKSGISQDFITPMFNFYKSICELHMAQEEQALLTAVTILTPDRPYVKDQQAVERL
QEPMLDVLRKLCALQHPQEPQYFARLLGRLTELRTLNHFHAEMLTSWRTNDHKFTPLLCE
IWDVQ
Download sequence
Identical sequences I3KBI3
ENSONIP00000018478 XP_013124133.1.78416 XP_019217032.1.78416 XP_019217033.1.78416 ENSONIP00000018478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]