SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018961 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018961
Domain Number 1 Region: 609-801
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-62
Family Sec7 domain 0.00000737
Further Details:      
 
Domain Number 2 Region: 817-948
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000119
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018961   Gene: ENSONIG00000015064   Transcript: ENSONIT00000018978
Sequence length 1141
Comment pep:novel scaffold:Orenil1.0:GL831142.1:5191047:5220386:1 gene:ENSONIG00000015064 transcript:ENSONIT00000018978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSLLENPVQAILYLRELTTIVQNQQSLIQTQRARIEELDRRVDELIGENRHLRDHHHH
HPQDPPLKTSPGSLPDAASPAQVEAAPVVQSSPTQPMDPGDMQLVPAEPSTISPVEKTHG
YAYGGEPHLARGANSNQPFSGERKAERYKEKERHAWCCCRRMAVTMDKLELTLGVEVLQQ
LPEQSETVLHQFCCPAPEHPETETTGSSRHINGNLGLRIVAFTAIKENKEISVHNIKKGL
EQLDQQTRRKLININGQMLSLEDGTSSGDRQETEGTKREGPSEYESTLENKNKQIEELEQ
KYGGHLIARRAARRIQTAFRQYQLSKNFQKIRNSLSESKLPRRISLRHPSPSGRNRNAAQ
RHSYTLHPGGGQIPLRSKTPPPPPCRSTSLPPSSRPSLTQLEDCFSEQLHSLAQSIDEAL
RGWSLSEGGEGKGLLMDPGALRAAAESACLPRSASSLLMAFRDVTVHIDSNSSYTISSAT
TTTTTTSLGNAGGGQPGSRKTSVSGMAGGGDNQSVEEPEFPAPPPSEELEMVDLGSRRGS
AVPTAGGGGMEGENSTDRLGSSSTSTSTSTSISTISGGPSPEALQALVVSLPRDRCQDPA
SCRSPTLSTDTHRKRLYRIGLNLFNVNPERGIHFLITRGFVPDTAIGVAHFLLQRKGLSR
QMIGEFLGNSKLQFNRDVLDCVVDEMDFSGMELDEALRKFQAHVRVQGEAQKVERLIEAF
SQRYCMCNPDVVQQFHNPDTIFILAFAVVLLNTDMYSPNIKPQRKMGLDDFIRNLRGVDD
GADIPREMVAGIYERIQQRELRSNEDHVTYVSRVEQSILGLKTILAVPHRRLVCCCRLFE
VPDANKPHKQKLSQLQREVFLFNDLLLILKLCPKKKSSASYTFCKAMGLLGMQFHLFSNE
YYAHGVTMMSPFTSEKKQLVSFCSPSGEELRKFAEELRESIAEVNEMEQIHIQWELERQQ
GIQPHGLHTNGGQMDAHTGHGSPSVKKSQDAYDKTGNNNTVEVSIHNRLQTYQLSQPSIE
STPLALAAPPALLSPVQAGDLRPETLIQCQQIVKVIVMDQSGRGRMEAFLSQGPATHQLV
QSALSTPARVREGDGPQPPLPPPPPPYNHPHQFCPPDSPMPLHHTMPLTRRRNSSGSRSI
V
Download sequence
Identical sequences I3KCW6
ENSONIP00000018961 ENSONIP00000018961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]