SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019045 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019045
Domain Number 1 Region: 128-331
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-40
Family Nuclear receptor ligand-binding domain 0.0004
Further Details:      
 
Domain Number 2 Region: 79-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-29
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019045   Gene: ENSONIG00000015133   Transcript: ENSONIT00000019062
Sequence length 348
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:5827007:5834805:-1 gene:ENSONIG00000015133 transcript:ENSONIT00000019062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVWRGSQDDVADTQGTLSSQTQGGLSLPTPQAGQLNLTASQVAPPTPQTPVQGPPNN
TQSTPTNQTSQQSEKQPQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRA
NRNCPIDQHHRNQCQYCRLKKCLKVGMRREVSLFTAAVQRGRVPPTQPHHGQFALTNGDP
LHCHSYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARMLFSAVEWARNIP
FFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDH
IRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKTIDCTLKFSVCECH
Download sequence
Identical sequences I3KD50
ENSONIP00000019045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]