SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019229 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019229
Domain Number 1 Region: 155-435
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-71
Family Nuclear receptor ligand-binding domain 0.00000000895
Further Details:      
 
Domain Number 2 Region: 103-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-30
Family Nuclear receptor 0.0000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019229   Gene: ENSONIG00000015282   Transcript: ENSONIT00000019246
Sequence length 437
Comment pep:known_by_projection scaffold:Orenil1.0:GL831316.1:131551:168885:-1 gene:ENSONIG00000015282 transcript:ENSONIT00000019246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEDRHLSSSCGSYVKTEPSSPSSSLIDTGSHHSPSGNSDASGGYVNVGSGRSHTLDSP
PMFNPGMLGGGSACLRRYEECSGGMADDSPIKCEYMLNGIPKRLCLVCGDTASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRLDAENGAYLGLTLPPPAKKPLTKIVSHLLVVEPEKIYAMPDPTMPDGDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILVLSIVFRSLPCEDE
IMYAEDYVVDEEQARISGLLDLHVAILPLVRRYKKLRMEKEEFVTLKAIALSNSDPDSMH
IENIEAVQRLQDSLHEALQDFEGSQHPEDPRRAGKLLMTLPLLRQTATKAVQHFYSIKMQ
GKVPMHKLFLEMLEAKA
Download sequence
Identical sequences I3KDN4
ENSONIP00000019229 ENSONIP00000019229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]