SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019240 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019240
Domain Number 1 Region: 268-507
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-70
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 66-151
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-31
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019240   Gene: ENSONIG00000015289   Transcript: ENSONIT00000019257
Sequence length 519
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:7088644:7270862:1 gene:ENSONIG00000015289 transcript:ENSONIT00000019257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESPPDPASDPGNSASEPATPVRETPVNLETLRKADHPAPVRRQTCSSTNRGISVTKKTH
TSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNAAYSCPRQKNCLIDRTSRNR
CQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQRDHQQQPGEAEPLTP
SYGLSANGLTELHDDLSGYMDGHTPDGSKPDSAVSSFYLDIQPSPDQSGLDINGIKPEPI
CDFAPGSGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREELQQMTWQAFL
QEEVESYQNKPREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVV
FVRMCRAFDSQNNTVYFDGKYAGPDVFKSLGCDDLISSVFEFGKNLCSMHLSEDEIALFS
AFVLMSADRSWLQEKVKVEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCSRH
TEKLTAFKAIYPDIVRAHFPPLYKELFGSDFEQSMPVDG
Download sequence
Identical sequences I3KDP5
XP_003440478.1.78416 XP_008280364.1.38333 XP_018536032.1.34915 ENSONIP00000019240 ENSONIP00000019240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]