SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019369 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019369
Domain Number 1 Region: 101-115,149-178,208-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.95e-61
Family Nuclear receptor ligand-binding domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 32-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.83e-29
Family Nuclear receptor 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019369   Gene: ENSONIG00000015396   Transcript: ENSONIT00000019386
Sequence length 415
Comment pep:known_by_projection scaffold:Orenil1.0:GL831142.1:7835660:7837898:-1 gene:ENSONIG00000015396 transcript:ENSONIT00000019386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLDTLKDFTQQSTDGAQAEKGLRKSFGQGLLCKVCSDSSSGKHYGIFTCNGCSGFFKR
SVRRRLVYRCQAGNGRCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAHISPD
SINVDTKKEHLVTTQALSPSDTYSAVISRPLVTSSAPTSATVKPCSNISNNHRFMVSLLT
AETCAKLEPEDVEENIDVTTNSERDLTPFDSRLSPYTSSCPENVYETSARLLFMSVKWAK
NLPVFAHLPFRDQVILLEEAWSEMFLLCAIQWSLPMDSCPLLSLPDLSIPQQANISLLTA
DLQILEEVFSRFKALTVDPTEFACLKAIVLFKPEVRNLKDPEQVENLQDQSQVLLGQHIH
SVYPNQGASPTRFGRLILLLPSLRFVNSEKIAKLFFQRTIGSTPMEKLLCDMFKN
Download sequence
Identical sequences I3KE24
ENSONIP00000019369 ENSONIP00000019369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]