SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019425 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019425
Domain Number 1 Region: 155-378,422-472
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-42
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 
Domain Number 2 Region: 587-727
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.1e-19
Family Glycerol-3-phosphate transporter 0.02
Further Details:      
 
Domain Number 3 Region: 495-576
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000157
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019425   Gene: ENSONIG00000015437   Transcript: ENSONIT00000019442
Sequence length 738
Comment pep:known_by_projection scaffold:Orenil1.0:GL831304.1:1096361:1151203:1 gene:ENSONIG00000015437 transcript:ENSONIT00000019442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETHNNRTSLVKGAKDIAKEAKRQAAKNFSKAVDRASDEYSTHRSYNRFQNEDEEENNY
NSYTQQDGLYADNATNEEDGASSDATEGHDDEDEIYEGEYQGVPAYNDGKPRDGQVALGQ
PVSDSLKSRKELENERQADEEELAQQYELIMQECGHGRFQWQLFFVLGLALMSDGVEVFV
VGFVLPSAETDMCVPNSGAGWLGSIVYLGMMFGAFFWGGLSDKVGRRQCLLISMSVNGFF
AFLSSFVQGYSMFLFCRMVSGFGILKFFPTLLALLSEAVSANSSGSNKGPTCICYPVGGE
IQAQHRWAIIPLMSAGWSFSMGSAYQFHSWRVFVVVCALPCVSAVVALTFMPESPRFYLE
MGKHDEAWMVLKHIHDTNMRARGEPERVFTVNRIKIPKQLDELVEMQNESANPVLKVLFK
IRAELRGIWLTFMKCFNHPVKENTMKLAAVWFTLSFGYYGLSVWFPDVIKHLQADEYASR
VKIHNNERIEDFTFNFTLENQIHRNGVFVNDRFISMKFKAVTFIDSSFLNCYFEDVSSVG
SFFRNCTFVDSFFYNTDIDDTKLTNSRVINSSFHHNKTGCQMTFDDDYSAYWVYFVNFLG
TLAVLPGNIVSALLMDKIGRLSMLGGSMVLSGISCFFLWFGTSESMMIFMLCLYNGLSIS
AWNSLDVVTTELYPTDRRGTGFGFCNAMCKLAAVLGNLIFGSLVGITKAIPILLASSVLV
GGGLVGLRLPDTRANVLM
Download sequence
Identical sequences I3KE80
ENSONIP00000019425 ENSONIP00000019425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]