SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019490 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019490
Domain Number 1 Region: 7-268,318-379
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000785
Family Plakophilin 1 helical region 0.079
Further Details:      
 
Domain Number 2 Region: 143-254,1239-1444,1471-1655
Classification Level Classification E-value
Superfamily ARM repeat 0.0000064
Family Plakophilin 1 helical region 0.09
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019490
Domain Number - Region: 708-826
Classification Level Classification E-value
Superfamily Sec7 domain 0.000353
Family Sec7 domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019490   Gene: ENSONIG00000015488   Transcript: ENSONIT00000019507
Sequence length 2227
Comment pep:known_by_projection scaffold:Orenil1.0:GL831318.1:1136400:1186657:-1 gene:ENSONIG00000015488 transcript:ENSONIT00000019507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEILRKLQKDASGHKYKGIRDACVYACEMLQSQNGSAKISPSLLRERCLLPLQMALESK
NTKLGQTALTGMQKLLCEDRFVGGTSVEVEALEKQLLSQMLEAIRVTPSLHEDLQVEVMK
VLLCITYSPNFDINGDSILRIAEVMIETYVSSCHQRSINTAVRATLSQILGDLTLQLRHR
QEVTQYFNYIHTDILYRYISPTSQALCEDVVTVLTVFCEKLESVDSDNQLLQLLYLECIL
SMLSSCPPTMHLFRGFTDLVWKQLCPSLVAIMGNPVNDKTIASHHGYSAGMGQEVDSSCG
GLSDQGRGSGCSSSAPARIAPVVRTVCYIAAELVRLVSCVESMKPVLQSLYHRILLYPPP
QHRTEAIRIMKEILGSPQRLYDLAGPCMAEPETRKRSFSKRKSHLDLLRLVMDGMTEACM
KGGIEACYSSVSCACALLSALDELSQGRGIQPEQARLLLRRLDDLKDGTESTRESMEINE
ADFRWQRHILSSEQPPWDPSSSSSNVATTSATERSPDISISITTETGQTTLDLEETKHEP
IPRPDQGGQKEEGGVPTGEAEGRGEKERGGGGERGGAVPPDVVQRSHALVYPDITNFLSV
ESRSRSHHGGGSRYSESNFSMEEQDLSRTEFDSCDQYSMAAEKDSGRSDVSDIGSDNVSL
ADEDQQLSRDFPGHRSLRTAALSLKLLRNHEADQQSARLFVQSLAGQLPRLLGLSTATEV
DLLLQNFSSTFCSGLQAGGIHSPGFETGDTLSCQYLMNADGLYLVSYYALLLNLKLCCCG
YYKRRTLTPVLSLKEFVRLIQSSGVLVVLSQAWIEELYHQVLERNLLAEAGFSGSSEDHT
LHCDFSVPPLLDIDGLGSSAIGGQLIRRASSHAPLGCEKPCSDTVMAGAVFSRFILTGVW
KNLIDVLSTPLTGRMAGSSKGLAFILGAEGVKEQSQRERDTICLSLDGLRKAAALSCALG
VAANCASALAQMAAASCVQEEKEEKEVGETGDAIAQAHLSVEQRLEQIGRPQGVRLHTAH
VLCMDAILNVGLEMGSHNHDCWPHVFRVTEYISSLEHTHFSDGSAQPSSLTTITQQSQQM
AGIDLGLELSCEPSPEASDLSLSQPVIQPLSIQELLKESGRGGRGLDLKSGSLMTGTSAA
KAVCTLSTQADRLFEEGATKLNLVGLVGFLQQLRKASQSQLFDSPTETGDYSLAMPGEAK
STLDRRSALHLFRLGEAMLRIVRNKNRPLLHMMRAWSVVAPHLVEAACHKERHVSQKAVS
FIHDVLTEVLTSWAELPHFHFNEALFRPFEHIMQLELCDEDVQDQVITSIGELVEMCSPQ
ILSGWRPLFSALRTVHGSKTDTKDYLLGEYSMGKSQAPVFDVFEAFINTDNIQVFANAAT
DYIMCLMKFVKGLGEVDYKEIGDCVHASGYSSTDLCLPALDYLRKCSQLLAKIYKMPSKP
VFLGARLASLPMRSQERSISSEDGMDCVLQEFDDDTGLIQVWILLLEQLTAAVSNCPRQH
QPPTLELLFTLLREVTAVPGPGFGIFAVIQLLLPVMSLWLQRSHGDHSYWDVAAANFKHA
IGLSCELVVEHVNSFIHSDIGYESLINHMLKDLFKLLVACVSEPAETISRVGCSCIRYVL
VTVGPVFTEEMWRLACCALQDAFSATLEPVKNLLACFHSGSDSFSGDACEVKVAAPSHSP
SAEAEYWRIKAMAQQVFMLDTQCSPKTPNNKEGFEHAQSCVLIIELPSDQQSNGHAQKRI
PFRTIVVSLLSHQVLLQNLSDILLEEFVKQPEGHERVTPVTSDPSKPTAGFLRYISMTNL
AIILDLLLDSYRTARDFDTRPGLKYLLMKVSGVCGAANLYRQSAMSFSLYFQALLCAILS
QADSMTAQQVKRILYDEEEGSSDSSRPGSASSEDEDIFEETAQVSPPRGRDKRHPWRAPV
PSLSVQPLGSADWAWLVKRLYKLCVDLCNSYIQMHRDLESTLEETALLRGSAGGDHVFFL
PLFQSETSTPTSAGGLSARETPSEEGGYRCQTTDVSSASPGDTPTPSPGFSAGTGRRKEW
WESAGNKLYTIATDRTISKLMMEYKRRKQQQQQPQQSHVNLFMKEQGRAAAAGGGGGIGE
RRGPVEPQRPPQRPQQLVDQQGPSLRHSVSAGPEVLRQEKRPRSGSTISSHSISLRDSEA
QIQAAWTNMVLTLLNQVLLLSDSSFLALQPALYPCLSQLSCHVTDARVRQALREWLGRVG
RLYDIIV
Download sequence
Identical sequences I3KEE5
ENSONIP00000019490 ENSONIP00000019490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]