SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019631 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019631
Domain Number 1 Region: 229-478
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.91e-67
Family Nuclear receptor ligand-binding domain 0.00000000289
Further Details:      
 
Domain Number 2 Region: 14-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.46e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019631   Gene: ENSONIG00000015603   Transcript: ENSONIT00000019648
Sequence length 487
Comment pep:known_by_projection scaffold:Orenil1.0:GL831252.1:429682:471453:1 gene:ENSONIG00000015603 transcript:ENSONIT00000019648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFVISAMKAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCL
IDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRLQQQQQQGHHLL
SHPSLGSPSPVESESLSSHYTLSSTGLTELPDEGGHYVEQNSPEGGSLSSKGDSAGGGEG
GGGGFYLDIQPSPDQSGLDINGIKPEPLCDYGSSNGFFPYCSFSNRDVPPTVPMAELDHL
AQIISKSHLETCQYLREELQQMSWQSFLQDEVESYQSKPQEVMWQLCAVKITEAIQYVVE
FAKRIDGFMDLCQNDQIVLLKAGSLEVVFLRMCRVFDSQNNTVFFDGKFAGPEVFKALGC
DDFITAVFDFAKSMCSLHLSEDELALFSAFILLSADRSWLQEKLQVEKLQQKTQLALQHV
LQKNQREDEVLNKLRCKASALRSLCSRHTEKLCTFRAVYPDIVRTHFPPLYKELFGADLE
LTLQSSN
Download sequence
Identical sequences I3KET6
ENSONIP00000019631 ENSONIP00000019631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]