SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019841 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019841
Domain Number 1 Region: 170-341
Classification Level Classification E-value
Superfamily Sec7 domain 6.8e-59
Family Sec7 domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 388-521
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-26
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019841   Gene: ENSONIG00000015763   Transcript: ENSONIT00000019858
Sequence length 653
Comment pep:known_by_projection scaffold:Orenil1.0:GL831239.1:229983:254325:1 gene:ENSONIG00000015763 transcript:ENSONIT00000019858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNKDGFSSTFERIVESALLRGGTCYSSLDSLDVLSLTDETDSCVSFEAPLTPLIQQRALL
QGPEEQEGAEVGPDAPGPELGAGDSAGAVAGVGGSPLRTTIPGSRSEFVLSQPGRWAIPN
GYHTDCQGDMINSVRDDIGLKTIISTASNDANLTDVLSDSEECDLGSLEHGSTDTLANGC
RADCEAAKRLAKRLYHLEGFKRCDVARHLGKNNEFSQMVASEYLSFFDFSGLSLDRALRN
FLKAFPLMGETQERERVLVHFSRRYCHCNPQTPTSEDGAHTLTCALMLLNTDLHGHNIGK
KMSCQQFISNLEGLNNGKDFPKDLLKVLYNSIKNEKLEWAVEEEELRKSLSELVEEQCEG
GSKRVARVTDGSNPFIAIPILLNAVTYKHGVLTRKSHADMDGKRTPRGRRGWKKFYAVLK
GMILYLQKDEYKPDTDISEVDLKNAVRIHHALATRATDYSKRANVLKLKTSDWRVFLLQA
PSEEEMMSWIFRINLVAALFSAPAFPAAIGSMKKFCRPILPSSSTRLNQEDQLLSHESKL
KQMSLELEEHRKNIPSADPKSREWEEYRLKEHYLAYEKTRYETYISLLQAKIRTETDDLE
KIEASVMGGLIMEGGLAGRECHLRKTQSSPSISQAHGGLNGRAAGCAVPGKRS
Download sequence
Identical sequences I3KFE6
ENSONIP00000019841 ENSONIP00000019841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]