SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019842 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019842
Domain Number 1 Region: 158-329
Classification Level Classification E-value
Superfamily Sec7 domain 6.28e-59
Family Sec7 domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 376-509
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-26
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019842   Gene: ENSONIG00000015763   Transcript: ENSONIT00000019859
Sequence length 624
Comment pep:known_by_projection scaffold:Orenil1.0:GL831239.1:229983:254271:1 gene:ENSONIG00000015763 transcript:ENSONIT00000019859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNKDGFSSTFERIVESALLRGGTCYSSLDSLDVLSLTDETDSCVSFEAPLTPLIQQRALL
QDAPGPELGAGDSAGAVAGVGGSPLRTTIPGSRSEFVLSQPGRWAIPNGYHTDCQGDMIN
SVRDHEQPLELFLFSCDDANLTDVLSDSEECDLGSLEHGSTDTLANGCRADCEAAKRLAK
RLYHLEGFKRCDVARHLGKNNEFSQMVASEYLSFFDFSGLSLDRALRNFLKAFPLMGETQ
ERERVLVHFSRRYCHCNPQTPTSEDGAHTLTCALMLLNTDLHGHNIGKKMSCQQFISNLE
GLNNGKDFPKDLLKVLYNSIKNEKLEWAVEEEELRKSLSELVEEQCEGGSKRVARVTDGS
NPFIAIPILLNAVTYKHGVLTRKSHADMDGKRTPRGRRGWKKFYAVLKGMILYLQKDEYK
PDTDISEVDLKNAVRIHHALATRATDYSKRANVLKLKTSDWRVFLLQAPSEEEMMSWIFR
INLVAALFSAPAFPAAIGSMKKFCRPILPSSSTRLNQEDQLLSHESKLKQMSLELEEHRK
NIPSADPKSREWEEYRLKEHYLAYEKTRYETYISLLQAKIRTETDDLEKIEASVMGGLIM
EGGLAGRECHLRKTQSSPSISQAH
Download sequence
Identical sequences I3KFE7
ENSONIP00000019842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]