SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019920 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019920
Domain Number 1 Region: 61-254
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-79
Family Sec7 domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 262-381
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-34
Family Pleckstrin-homology domain (PH domain) 0.00000148
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019920
Domain Number - Region: 14-71
Classification Level Classification E-value
Superfamily FlgN-like 0.0719
Family FlgN-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019920   Gene: ENSONIG00000015825   Transcript: ENSONIT00000019937
Sequence length 399
Comment pep:known_by_projection scaffold:Orenil1.0:GL831148.1:161341:173668:1 gene:ENSONIG00000015825 transcript:ENSONIT00000019937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLHILLSSVPDDLSPEERQELDSIRRRKQELLQDIQRLKDEIAEVTSEIENLGLTEERK
NMQRNRQMAMGRKKFNMDPAKGIRFLIDCSLLKNTSEDIAQFLYKGEGLNKTAIGDYLGE
RDEFNIKVLHAFLELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFARRYCHCNPG
VFQSIDTCYVLSFAVIMLNTSLHNPNVKDKPSVQKFTAMNRGINDGGDLPEDLLRNLYDS
IKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDK
EPRGIIPLENLSIREVEDSKKPNCFELFIPNHKDQVIKACKTEADGRVVEGNHTFYRISA
PTAEEKDEWIKSIKAAISKDPFYEMLAARKKKVSSLKGL
Download sequence
Identical sequences I3KFM5
ENSONIP00000019920 ENSONIP00000019920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]