SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020795 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020795
Domain Number 1 Region: 126-373
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-69
Family Nuclear receptor ligand-binding domain 0.0000000111
Further Details:      
 
Domain Number 2 Region: 58-140
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020795   Gene: ENSONIG00000016515   Transcript: ENSONIT00000020814
Sequence length 463
Comment pep:known_by_projection scaffold:Orenil1.0:GL831365.1:174547:179365:-1 gene:ENSONIG00000016515 transcript:ENSONIT00000020814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICWPKELADMDMADYSEALDPAYTTLEFENMQVLPLGADSSPAESANMNAASHLAAGSLC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALIQADVLSRQITSPAPILNGDIRTKK
IATITDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMLYK
DILLLGNDHIIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKG
LSDPGKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLF
GMAKIDNLLQEMLLGGSANEAPHAPHSLHPHLVQEHLSTNVIVTSNMPTPIHNGQISTPE
TPIPSPPAASSSEHYKMVQGVIATVPKQPTSIPQPTITKQEAI
Download sequence
Identical sequences I3KI50
ENSONIP00000020795 ENSONIP00000020795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]