SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021055 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021055
Domain Number 1 Region: 199-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-76
Family Nuclear receptor ligand-binding domain 0.00000000451
Further Details:      
 
Domain Number 2 Region: 94-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.06e-27
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021055   Gene: ENSONIG00000016715   Transcript: ENSONIT00000021074
Sequence length 468
Comment pep:known_by_projection scaffold:Orenil1.0:GL831226.1:111349:116861:1 gene:ENSONIG00000016715 transcript:ENSONIT00000021074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLISTMAGDHYSPPSPLGDSLLGSPLCGDLMEDLRDISQSIGGDALGFDFPEYQSTGSGS
NSSVALETLTPASSPSSGVCGAAAGQDESGSTLNLECRVCSDKASGFHYGVHACEGCKGF
FRRTIRLKLEYDKCERNCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPQAEKLKLK
EESKMVEKEVESPLMSDHKFLVRQIHDAYMKNFNMNKAKARLILTGKTSKPPFIIHDMET
FQLAERTLAVHMINSDYPESDSVLGQREAEARLFHCCQSTSVETVTELTEFAKAMPGFQS
LDLNDQVTLLKYGVYEALFTLLASCMNKDGLLVARGGGFITREFLKSLRRPFSDMMEPKF
QFATRFNSLELDDSDLALFVAAIICCGDRPGLVDVPLVEQLQESIVQALRLHLLANHPDD
TFLFPRLLQKLADLRELVTEHAQLVQEIKTTEDTSLHPLLQEIYRDMY
Download sequence
Identical sequences I3KIW0
ENSONIP00000021055 ENSONIP00000021055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]