SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021216 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021216
Domain Number 1 Region: 712-899
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-65
Family Sec7 domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 915-1046
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021216   Gene: ENSONIG00000016837   Transcript: ENSONIT00000021235
Sequence length 1448
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:3525661:3551925:1 gene:ENSONIG00000016837 transcript:ENSONIT00000021235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGRAPTMDTSPESPNRAVEYLLELNNIIESQAKLLETQRRRIEELEGQLDRVSQENQDLR
QERSPRTPGTDTPEQNYNHNQPLSLPIHHHRHQHQFHLAPKKDLNFLDKAGCLSNTHAHV
LRSRIRETGYQLVEDGGGGGGDKNALYLKLHQKSLFVSRSEPGQAGDNGEKKKKEKKGGQ
VRAVFMGPNYSCFPREEGEDERAHQRESERGCVYYYSVPVSVGLSLTVAACVEGESQCPE
TGTHKDTSFSQTPYLRGSERYSDSSSNAPSGSRGPSCVTASSSASLAWALRTRHQPASLA
LRKQEEEENKRCKALSDSYELSTDLQDKKVEMLERKYGGSFVSRRAAKTIQTAFRQYRMN
KNFERLRSSASESRMTRRIILSNMRLQYSFDERQPQQQAQTQTNFTHSVAVGPPHSPDPD
RTGDYTHLEDSFSKQVKSLADSIDDALTCRAGRDDSQEGSKGLGERGRGAGGGLSMHGDS
TATSYSDVTLYMDDGMPSSPLSLDRAPSSTDTEYWGPSGGVGGREDSRDTEGGGSSNSRR
STPCTECRDYRLRGAHLPLLTIEPPSDSSVDMSDRSDRGSLSRTLVFEQEPGSPQGTLKH
SPNTDHHPIHHHQYPDTPSSSSSPQQPPTTPLSSSSSTALPPGGLEQPCCSDGDNDSLNS
TTNSNETVNCSSGSSSQDSLREPLPPLGKQTYQRECRHSWDSPPFNSDVVQRRQYRIGLN
LFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEFLGNRQKQFNKDVLDCV
VDEMDFSGMDIDDALRKFQAQIKVQGEAQKVERLIEAFSQRYCVCNPTLVRQFQNPDTIF
ILAFAIILLNTDMYSPNVKPERKMKLEDFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELR
TNDDHVSQVQAVERVIVGKKPVLSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLFND
LLVVTKIFQKKKTSVTYSFRQSFPLVEMQVHMFQNSYYPHGIRLTSAVLGGERKVLIVFM
APSQQDRTRFVSDLRESIAEVQEMEKYRVESELEKQKGVMRPSLLTGGVVGGGVGVKSDV
VNGTLGRTSFDDNCSVGEGLKRTALSSSLRDLSDTGKRGRRNSVGSLDSTMEGSIISSPQ
PHQRYPLPGVLPGCYGTEDFRPHRPINNSGSFLGSLFGSKRAKPPGPLIPPGPPYPAPVP
PPTTGGPPPHSPSSLCQLEGGASKLQALHAQYCHAGTVQPPPPYYHHHRYHIQTVPPPLP
GVPPHTIQRGPLPCRPPLGPPHAQHPQLAHLSQLSQHGLPGRYANIGAGGPGTKPPLTLS
LSHPHAHSQTHPGHAHTPHPVSHSTHQTHFIFGTLPHNLPSATVNAHHAASAGPYLPQYP
PLSSIPPPPPHSPLPPPSSPLTPLTPLSPHPPQHPGQPQQGPQVTGAGATGTGGSSKSKP
INRISTVV
Download sequence
Identical sequences I3KJC1
ENSONIP00000021216 ENSONIP00000021216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]