SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021360 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021360
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-77
Family Sec7 domain 0.0000000478
Further Details:      
 
Domain Number 2 Region: 259-378
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-34
Family Pleckstrin-homology domain (PH domain) 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021360   Gene: ENSONIG00000016937   Transcript: ENSONIT00000021379
Sequence length 399
Comment pep:known_by_projection scaffold:Orenil1.0:GL831346.1:1022975:1032138:-1 gene:ENSONIG00000016937 transcript:ENSONIT00000021379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FENNIHISSDFTPEEKMEIKTITTYKKDLLDDIQKLKMEIDNVMAEILSFESAEENKAIE
KNKQFANGKKKFNMDPKKGISYLVEIKLLDGSAQSIAEFLYKEEGLNKTAIGEFLGEREE
LHLQTLKAFVELHEFSDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCDCNPDVFQ
STDTCYILSFAIIMLNTSLHNPNVKDKTTLERFISMNRGINNGEDLPNDLLSKLYESIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLCVREVHYPRKPYCLELYNPNSRGQKIKACKTETDGRVVEGKHQSYTICASSA
EERDSWIEAIRASITKDPFYDLVSVRKKKVIHQTPQDSA
Download sequence
Identical sequences I3KJR5
ENSONIP00000021360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]