SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021628 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021628
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 3.01e-80
Family Sec7 domain 0.00000000996
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-34
Family Pleckstrin-homology domain (PH domain) 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021628   Gene: ENSONIG00000017152   Transcript: ENSONIT00000021647
Sequence length 394
Comment pep:known_by_projection scaffold:Orenil1.0:GL831339.1:462520:504496:1 gene:ENSONIG00000017152 transcript:ENSONIT00000021647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDNQVPEDLSLEERDELSNIRRRKKELLDDIERLKFEIAEVMTEIEQLTCVGESKTTQ
RNKQIAMGRKKFNMDPKKGIQFLLENDLLQNTPEDIAQFLYKGEGLNKTVIGDYLGERDD
FNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQ
STDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEELLRNLYDSIKS
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVEEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTP
EEKEEWIKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences I3KKI3
ENSONIP00000021628 XP_003456383.2.78416 XP_004558371.1.88231 XP_005734711.1.53837 XP_005925455.1.24487 XP_006791540.1.46954 XP_008301665.1.38333 XP_018526324.1.34915 XP_019108780.1.61708 XP_022051242.1.10920 ENSONIP00000021628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]