SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021643 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021643
Domain Number 1 Region: 177-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-77
Family Nuclear receptor ligand-binding domain 0.00000000298
Further Details:      
 
Domain Number 2 Region: 127-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.38e-25
Family Nuclear receptor 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021643   Gene: ENSONIG00000017162   Transcript: ENSONIT00000021662
Sequence length 460
Comment pep:known_by_projection scaffold:Orenil1.0:GL831287.1:1332328:1377159:-1 gene:ENSONIG00000017162 transcript:ENSONIT00000021662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSMSLCVCAVFGMTEQQRLLCRMSSKERHLESSCPSSYIKTEPSSPASLTDSLNHHSPGG
SSDASGSYSSTMNGHPNGLDSPSLYGSNAGPLGPAGGPGSKRYEDCSSTIGEDSQIKCEY
MLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRK
SCQACRFMKCLTVGMLREGVRLDRVRGGRQKYKRRIDADNSPYLNPQLALPPKKPYNKIV
SHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVNIGWAKHIPGFSTLSLADQM
SLLQSAWMEILILRVVYRSLPFEDKLVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKS
MKLEKEEFVTLKAIALANSDSMHIEDVDAVQKLQDVLHEALQDYEASQHQEDPRRAGKLL
MTLPLLRQTSTKAVQHFYSIKQDGKVPMHKLFLELLEAKV
Download sequence
Identical sequences I3KKJ8
ENSONIP00000021643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]