SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021662 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021662
Domain Number 1 Region: 512-701
Classification Level Classification E-value
Superfamily Sec7 domain 1.18e-66
Family Sec7 domain 0.00000569
Further Details:      
 
Domain Number 2 Region: 733-857
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000144
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021662   Gene: ENSONIG00000017176   Transcript: ENSONIT00000021681
Sequence length 1112
Comment pep:novel scaffold:Orenil1.0:GL831137.1:6694969:6706653:-1 gene:ENSONIG00000017176 transcript:ENSONIT00000021681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSCHCSVEGDARPSDSGPSLDGGASYGQGPVTHGSAISPDRFDSPLYSHGVQPGPQRPRR
PKLQHSQSILRKQAEEEAIKRSRSLSESYELSADLQDKQVEMLERKYGGRFITRHAARTI
QTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQLSFEGPEKVHSSYFEGRQVSMTE
DGTPLSMVQSECGDIEVHQQANMAHPPPQGDLTDAITELEDAFSRQVKSLAESIDDALNC
RSLQGDEGPDPEAIGCSERQGDVQYQVKSHHRAAGRMRDETMASYSDVTLFIDEEDMSPS
IALSRSGDQPSSTESDLRLRSVNSSQEYWPIDPKDEGRDTDTSCRSTPSLECQEQRLRMD
HLPLLTIEPPSDSSAELSDRSERSTVKRPPVYEPHGHIVTSSQASPKHISHGPPPRAPSR
DDDAPLRHRHRQLESHLAINGSANRQSKSESDFSDGDNDSINSTSNSNDTINCSSESSSR
DSLREQTLSKQTYHKETRNSWDSPIFSNDVIRKRHYRIGLNLFNKKPEKGIQYLTERGFI
PDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFQGMELDEALRKFQ
NHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFILAFAIILLNTDMYSPNVK
PERKMKLEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKTNEDHVSQVQKVEKLIVGK
KPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLHQREIFLFNDLLVVTKIFQ
KKKNSVTYSFRQSFSLYGMQVMLFENQYYPNGIRLTSAIPGADIKVLINFNAPNPQDRKK
FTDDLRESIAEVQEMEKYRIESELEKQKGVVRPSMSQSSGLKKEAGNGNMNRASLDDSYA
MGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLDSNVEGSIISSPHTRRRANTPRESVPRG
HPSIPNSASTSILGSLFGSKRGKPPSQSHPPFPQPGHPTLISHKPHPTNLHHTAQVVHTV
QTQHHGHHPQYCPQNPPPYHHHHHYHPPPHTQYHQHPAYSSHAHQHGHSQHGHYSQHSHH
TSHSQHSHHHSQQVGSAPGGPKPKHSGISTVV
Download sequence
Identical sequences I3KKL7
ENSONIP00000021662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]