SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021743 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021743
Domain Number 1 Region: 386-618
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-60
Family Nuclear receptor ligand-binding domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 142-223
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.97e-31
Family Nuclear receptor 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021743   Gene: ENSONIG00000017240   Transcript: ENSONIT00000021762
Sequence length 630
Comment pep:known_by_projection scaffold:Orenil1.0:GL831137.1:7355452:7368704:-1 gene:ENSONIG00000017240 transcript:ENSONIT00000021762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSNLNLLSQQKVDSEHEAEVSSSPSDSVMSESPQRFQVISTEPSTPQRIQIVTDQQTGQ
KIQIVTAMNPSSAPKQQFILTTADSSGAGKVILASPDSHNAKQLIFTAADSLVPGRIQIV
TDPVSMERLLGQSGDLSRPQPVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYS
CRSKQDCVINKHHRNRCQFCRLRKCLKMGMKTESVQSERKPIDIVPRERHANCAASTQKI
YIRKDLNSPLIATPTFISDTETDGSRSSLLDQGMLVNIQQPVIQSDGTLVLATDSKMDCG
QGDLGTLANVVTSLANLSDSLKENLNNGDTSDSQHEEQSASEITRAFDTLAKVFNPPEVG
VEDSLTDKSQCVSGTTIQLIGRDQETPIIEVEGPLLTDSHVSFKLTMPSPMPEYLNVHYI
CESASRLLFLSMHWARSIPAFSALGQEANTSLVRACWNELFTLGLAQCAHVMNLSTILAA
IINHLQSSIQDDKLSGERVKQVMEHIWKFQEFCNSMTRLETDSYEYAYLKAIVLFSPDHP
GVDSSGQIEKFQEKALMELQDYVQKTYPDDTYRLTRILTRLPALRLMNSSITEELFFTGL
IGNVSIDSIIPYILKMETAEYNSQDSDSTE
Download sequence
Identical sequences I3KKU8
ENSONIP00000021743 XP_003438891.1.78416 ENSONIP00000021743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]