SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022113 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022113
Domain Number 1 Region: 443-685
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-58
Family Nuclear receptor ligand-binding domain 0.000000039
Further Details:      
 
Domain Number 2 Region: 303-378
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.73e-23
Family Nuclear receptor 0.0000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022113   Gene: ENSONIG00000017538   Transcript: ENSONIT00000022132
Sequence length 688
Comment pep:known_by_projection scaffold:Orenil1.0:GL831174.1:416665:426182:1 gene:ENSONIG00000017538 transcript:ENSONIT00000022132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFHSFLEETNSLTMNEGDRLDTTTYACPAYELSKAVSVSLGLDSVSSPPNNMNQSSSSA
FAECDSGTVADSSRGVPELRRAGNMNSDGSMFVLGDSSLREDDFGEVCQGIQQVSCMDLF
GSGEMDSAQTVTRGSVISRYVCRESNVFMNPTPELPAPPQVPGVVPLKPPSSYCASSDLY
RDLPPEMWCANERAYSDRSQPQPQRGESGEHNFLCKYCNCGQAPRGNRQECRCIWYGRGD
QGGKGGMRATAQGYGQMSSYPSAIPQGQNTFSTIKSEPSVWMNCTDRSLRHEDFFPGVYL
SERRVCQVCGDDASGCHYGAVTCGSCKVFFKRAAAGKQNHLCASRNDCTIDKLRRKNCAS
CRLKRCFMSGMSLKGRRLKGAGQARNGEEEQQLASWGQGEKEERAAKKDVVLESGNAGVR
AQGAASQALGAAIPPPLHSCLSLLSILQAIEPAVVNAGHDPAQPDSPMSLLTSLNKLGER
QLVTVVRWAKAIPGFRDLHVDDQMSVIQLSWMGVMVFALGWRSYTLTNSSMLYFAPDLIF
NDQRMQASSMYEHCVRMKLLSQRLCMLKVTQEEFLCMKALVLLSIMPEQGPKSQHCFDKL
RTSYIKELDRLASHRGETTRTQRLFQLTQLLDHLQSVVRKLHQFTYDLFIQAQSMHVSFP
EMISEIVSIHVPKILSGMVKPILFHNVA
Download sequence
Identical sequences I3KLW8
ENSONIP00000022113 ENSONIP00000022113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]