SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022375 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022375
Domain Number 1 Region: 4-88
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.11e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 
Domain Number 2 Region: 559-621
Classification Level Classification E-value
Superfamily F-box domain 0.00000122
Family F-box domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022375   Gene: ENSONIG00000017746   Transcript: ENSONIT00000022395
Sequence length 755
Comment pep:known_by_projection scaffold:Orenil1.0:GL831441.1:464107:478798:-1 gene:ENSONIG00000017746 transcript:ENSONIT00000022395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMAEELLETVERLQSRLQENQEPRKLLKTLKRLGELPMTVDILVETGVGKAVNSFRKHEL
AGEMAKNLVAKWKKLVPQSGDRQARGHEASGRGDHKRPREPSPEEDRSYIEEEEEERGYH
TNYSPSPPQHDQYSPPQRGGYHSDEYESPEPEPEPEPSPPPPPPPVSRKDVRHTKPNKEP
SKNHHHHSDRNRDEERRQRHAQTSSEREGGGSQGKKRSGDRERHQSPVQKAAKHSKKSTM
HDSRKEEKKKGGDEVKTVVNLKITEEKKPSIVVKYQVHRNNFHFPLKIPIYLKIPTQPNK
VKGGNHCGSDKVKFSNKINETVSLFGSLTWLGSPDSSRFISPHVINYYLHLLGRPRVPKD
SPPKEEEEDFEVPTMSFESFLTYDAPTSVKKKKKMTLSASSSSHSRPSHSSSSTSSSHRT
RTPPPASSSSSSSSSKARKANGAQSTKRTHSGTTSSRCKEVPTVYEAVPTVPEIQLPAIQ
PNYRPLPSIDITPLSPQRRKVPVCNEEDDAGFTGKRFNSKMVVYSGSKTAYLPKMMTLYE
QCIRVLQNNIDSIAEVGGVPFDILEPVLERCTPEQLYRIEQSNQWFTEESDELWMRHCRR
DFKRESPQEYESWRELYLRLHDEREERLRMLTQNITSAHANKPKGRQVKMAYVNSVAKPP
RDVRRRQEKFGTTSGSTASSTAAAAPFKIRPATTDYSGESSQSSSSQNNPPSAGSSRFSA
PSGAGHAAREKPQVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences I3KMN0
ENSONIP00000022375 ENSONIP00000022375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]