SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022570 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022570
Domain Number 1 Region: 509-766
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-62
Family Nuclear receptor ligand-binding domain 0.0000000133
Further Details:      
 
Domain Number 2 Region: 424-503
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-25
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022570   Gene: ENSONIG00000017907   Transcript: ENSONIT00000022590
Sequence length 783
Comment pep:known_by_projection scaffold:Orenil1.0:GL831174.1:4540190:4562093:1 gene:ENSONIG00000017907 transcript:ENSONIT00000022590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKGGVKKIAYRRDDHLSKLVYTESPEEGGLLRVAPHSAMSVTSPASVVLPSSSLMQPGQ
VPNGLNNSPLPEELTSASVIATVGSLIDGPEPRGLTKDQRPQHQQQLLQTQTTFGHQTLS
ENLSQLDASMADITQSSMDSLIGGSDPNFFHLKTEDFSLDKGEQDPIDLDNAFEPIGKDM
DVNQKLFSDNTLDLLQDFDLTGSPSDFYVGDDAFLSTLADDSLLGVTSERDIKPAVVDSS
NTTGAVPVALNGSSVTNPAQSSPTISTTTSLSPETTLSAMVKKEKDANFIQLCTPGVVKQ
EKTGGQSYCQISGTASGDMAGTNAVSVCGVSTSGGQTYHFGVNPLSSDSQLQNEQKPVSS
LFLPVTTIGGVWNRGQGVGNNSLVQRAGEGFSGSPSYPTSFTSSISRQEGSTATSSTQGK
SGTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCP
ACRFRKCLMAGMNLEARKLKKNRLKGVQQSNPPEVAPSPPVETRSLVPKCMPQLVPTMLS
LLKAIEPDTIYAGYDSTLPDNSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMT
LLQYSWLFLMTFSLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMTDQFEQMLKICSEFV
RLQVSHDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQR
FYQLTKLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSIKPLLF
HQR
Download sequence
Identical sequences I3KN75
ENSONIP00000022570 XP_005467903.1.78416 XP_013127156.1.78416 XP_013127157.1.78416 ENSONIP00000022570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]