SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022860 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022860
Domain Number 1 Region: 328-490
Classification Level Classification E-value
Superfamily Sec7 domain 1.24e-56
Family Sec7 domain 0.0000518
Further Details:      
 
Domain Number 2 Region: 538-671
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-27
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022860   Gene: ENSONIG00000018143   Transcript: ENSONIT00000022880
Sequence length 794
Comment pep:known_by_projection scaffold:Orenil1.0:GL831200.1:1627662:1686788:1 gene:ENSONIG00000018143 transcript:ENSONIT00000022880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHCQKIARAKWEFLFGTPAEEAAGRDSPEGTSTAPPSAIIGTSPKTGIIRRTLKYSETD
LDAVPLRCYRETDIDEVLLAEQEDADSAFGSNRSVQGTSGTGSSPLGGLAYGRTDGEEEA
IREGRAVEEEGEEDEEEEEEEEEMFLSCVFRPVETFFDNHHPALKSPILVSGPRLATEDT
FSRHFESIMESHRAKGTSYNSLDSEELLTSSTHTVLTFDLPTLTPAIHATPPSPYPASPC
SQDLAESLKPEGRWNREGERESFETRERSVKACRPPGRECRCSPTLGLGSSAAGEEREKA
RLATDSELDQDLSDRLGLGSSDTLTNGSHRADVAAAKRLAKRLFNLDGFRKSDVARHLSK
NNDFSRMVAEEYLSFFSFTGLTLDQALRTFLRQFALMGETQERERVLSHFSRRYLDCNPK
VIPSEDAVHTLTCALMLLNTDLHGQNIGKRMSCTQFIGNLEGLNDGQDFPKELLKALYNS
IKNQKLQWTLDEEELRKSFSELGDSLCDSNTSRSMKRVGSSGKPLSDGLQPTGMLLYKNG
FLVRKVHADSDGKRTPRGKRGWKTFYAILKGLILYLQKGEYRPDKQLSDEDLKNAVSIHH
SLAMKASDYSKRPNVFYLRTADWRVYLFQAPNAEQMQSWITRINTVAAMFSSPPFPAAIG
SQKKFSRPLLPGTMSKLSEEEQVRSHEARFRAISTELAELRSYPPDRKVKGRELEEYRQR
DEYLDFEKTRYGTYVMLLRAKIRSGEEDLSVFESQLLEDNGLQRAHSSPTLQDSSQASLA
SSTRDGGNSSKASG
Download sequence
Identical sequences I3KP15
ENSONIP00000022860 ENSONIP00000022860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]