SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022979 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022979
Domain Number 1 Region: 160-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.18e-72
Family Nuclear receptor ligand-binding domain 0.0000000012
Further Details:      
 
Domain Number 2 Region: 50-138
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-28
Family Nuclear receptor 0.00000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022979   Gene: ENSONIG00000018247   Transcript: ENSONIT00000022999
Sequence length 409
Comment pep:known_by_projection scaffold:Orenil1.0:GL831200.1:2781824:2909930:1 gene:ENSONIG00000018247 transcript:ENSONIT00000022999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHMPKEQDSNPSEGEEKQWLNGPKRKRKNSQCSVKSMTGYIPSYLEKDEPCVVCGDKAT
GYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDGCCIIDKITRNQCQLCRFKKCIAVGMA
MDLVLDDSKRVAKRRLIEENRERRKKEEMVKSLQSRPEPTGAEWELIRLVTEAHRHTNAQ
GSQWKQKRKFLPEKIGQSPVAPTSDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSE
LPCEDQIILLKGCCMEIMSLRAAMRYDPDSETLTLSGEMAVKREQLKNGGLGVVSDAIFD
LGKSLAQFNLDDTEVALLQAVLLMSSDRSGLTCTDKIEKCQETYLLAFEHYINYRKHNIP
HFWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQEV
Download sequence
Identical sequences I3KPD4
ENSONIP00000022979 ENSONIP00000022979 XP_005453839.1.78416 XP_013128887.1.78416 XP_013128889.1.78416 XP_013128890.1.78416 XP_013128892.1.78416 XP_019217843.1.78416 XP_019217844.1.78416 XP_019217845.1.78416 XP_019217846.1.78416 XP_019217847.1.78416 XP_019217848.1.78416 XP_019217849.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]