SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023304 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023304
Domain Number 1 Region: 22-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-42
Family G proteins 0.0000000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023304   Gene: ENSONIG00000018509   Transcript: ENSONIT00000023324
Sequence length 198
Comment pep:known_by_projection scaffold:Orenil1.0:GL831242.1:1719286:1722729:-1 gene:ENSONIG00000018509 transcript:ENSONIT00000023324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLFDWIYRGFSSVLQLLGLYKKTGKMVFLGLDNAGKTTLLQMLRDDRLGQHMPTLYPT
SEELTIAGMTFTTFDLGGHTQARRIWKNYFPAINGIVYMVDCADHMRLAEAKVELDALLT
DETIANIPVLILGNKIDRPEAISEDALRGVLGLQGHTTGKGKVPLKELNLRPMEVFMCSV
LKRQGYGDGFRWLAQYID
Download sequence
Identical sequences I3KQA9
XP_003451998.1.78416 ENSONIP00000023304 ENSONIP00000023304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]