SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023364 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023364
Domain Number 1 Region: 36-111
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.57e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0018
Further Details:      
 
Domain Number 2 Region: 118-203
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.00000327
Family Elongation factor TFIIS domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023364   Gene: ENSONIG00000018559   Transcript: ENSONIT00000023385
Sequence length 207
Comment pep:known_by_projection scaffold:Orenil1.0:GL831198.1:2260349:2263843:1 gene:ENSONIG00000018559 transcript:ENSONIT00000023385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFVVRLPKGDTPKKSKTDEKVYKQTTIESLRRVVVIEDIMRYKSMLELPEQSKDNLLT
ALKELSKKVPSKEVLKSTKIGHTVNKMRKHLDHEVSSMAAKVYTDWRTFIEENSNKPSIE
VRSDKQSEGLRSNARRLMSEALEVKEDSGLIDNIEREVFHQSSRLVSTSYRRTVRALVFA
FKHNPEVRTQVKNSTIAVNKLVSKYKK
Download sequence
Identical sequences I3KQG9
ENSONIP00000023364 XP_003448527.1.78416 ENSONIP00000023364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]