SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023424 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023424
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.3e-72
Family Glutathione peroxidase-like 0.0000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023424   Gene: ENSONIG00000018611   Transcript: ENSONIT00000023445
Sequence length 198
Comment pep:known_by_projection scaffold:Orenil1.0:GL831264.1:441248:442589:1 gene:ENSONIG00000018611 transcript:ENSONIT00000023445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGNAHIGKPAPDFTAKAVMPDGQFHDLKLSDYRGKYVVFFFYPLDFTFVCPTEIIAFS
DAANEFRKIGCEVIAASVDSHFSHFAWVNTPRKQGGLGTMNIPLVSDTRRTISKDYGVLK
EDEGIAYRGLFIIDDKGILRQITINDLPVGRSVEETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKDFFSKQ
Download sequence
Identical sequences I3KQM9
ENSONIP00000023424 ENSONIP00000023424 XP_003453408.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]