SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023723 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023723
Domain Number 1 Region: 56-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-30
Family Pentraxin (pentaxin) 0.0000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023723   Gene: ENSONIG00000018840   Transcript: ENSONIT00000023744
Sequence length 231
Comment pep:known scaffold:Orenil1.0:GL831182.1:4021141:4022035:1 gene:ENSONIG00000018840 transcript:ENSONIT00000023744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQTDFSFNGHLVFMLLLLPLFYAYFSDLSGKQFTFPSDPKSVNQPRVALRANTRLITVMT
VCLRFFSQLNRMQGLFSLATRDHSNALMLNKDAEGSYKVHAGDDTYVFTKLPTNRMDWNS
VCWTWDSRTGLTQLWLNGLRTSQKLVGQNYLVRGDLSIIVGQEQDAYGGGFDRNDSFEGD
ITDLHMWDRVVSACDLRSYMNQGSFSPGNLLNWNNLNFEVSGNVSIQDADF
Download sequence
Identical sequences I3KRH8
ENSONIP00000023723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]