SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024125 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024125
Domain Number 1 Region: 134-413
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-76
Family Nuclear receptor ligand-binding domain 0.00000000193
Further Details:      
 
Domain Number 2 Region: 81-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.03e-27
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024125   Gene: ENSONIG00000019165   Transcript: ENSONIT00000024146
Sequence length 494
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:3432702:3467381:1 gene:ENSONIG00000019165 transcript:ENSONIT00000024146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANREHQVRHMTGYPRALYPFTFNSMRSHSPFDLLASSHLFGRFGADLPKEMAALSVET
QSTSSEEMVPSSPSPPPPPRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYT
CHRDKNCQINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPENYELSG
ELEELVNKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELSTKCIIKIVEF
AKRLPGFTTLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGF
GPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIY
TRRRRPNKPHMFPRMLMKVTDLRGISTKGAERAITLKTEIPGPMPPLIREMLENPDSFED
SSDSGDSGAAAPPAIQAIKQEDKATYESAFEEEEEEEEDDYWDEEKERGADSDGEAWGEA
AAGAQKKGVTGKTQ
Download sequence
Identical sequences I3KSM9
ENSONIP00000024125 ENSONIP00000024125 XP_013124655.1.78416 XP_019214497.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]