SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024126 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024126
Domain Number 1 Region: 126-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.95e-76
Family Nuclear receptor ligand-binding domain 0.00000000193
Further Details:      
 
Domain Number 2 Region: 73-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.03e-27
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024126   Gene: ENSONIG00000019165   Transcript: ENSONIT00000024147
Sequence length 486
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:3452527:3467381:1 gene:ENSONIG00000019165 transcript:ENSONIT00000024147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMEALGLAPRPLFDVSRQGSCMLSKAAPYFSGLDPFAWAGTSSVQSVETQSTSSEEM
VPSSPSPPPPPRVYKPCFVCQDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCQ
INKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKDVKEEVVLPENYELSGELEELVNK
VSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELSTKCIIKIVEFAKRLPGFT
TLTIADQITLLKSACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVF
AFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALKIYTRRRRPNK
PHMFPRMLMKVTDLRGISTKGAERAITLKTEIPGPMPPLIREMLENPDSFEDSSDSGDSG
AAAPPAIQAIKQEDKATYESAFEEEEEEEEDDYWDEEKERGADSDGEAWGEAAAGAQKKG
VTGKTQ
Download sequence
Identical sequences I3KSN0
XP_005469520.1.78416 ENSONIP00000024126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]