SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024393 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024393
Domain Number 1 Region: 139-431
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.44e-88
Family Nuclear receptor ligand-binding domain 0.0000000148
Further Details:      
 
Domain Number 2 Region: 32-119
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.15e-29
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024393   Gene: ENSONIG00000019378   Transcript: ENSONIT00000024414
Sequence length 436
Comment pep:known_by_projection scaffold:Orenil1.0:GL831146.1:5786023:5796971:-1 gene:ENSONIG00000019378 transcript:ENSONIT00000024414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPLISSLFLVMEPTVVSTSTVAPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFR
RSMKRKATFTCPFNGSCTITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKKDLIQR
RKDEEAQREAEKEARRPRLTEEQSQIIATLVEAHHKTYDDSYSDFCRFRPPVREGPVTRS
ASRAASLHSLSDASSDSFSHSPESVDTKMNFNNLLMMYQDQGSSPDSSEEEGSSFSMLPH
LADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFNLEDMSWSCG
GPDFKYQISDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDH
ARIEALQDRLSETLQAYIRLHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHS
MQLTPLVLEVFGSEVS
Download sequence
Identical sequences I3KTE7
ENSONIP00000024393 ENSONIP00000024393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]