SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000024980 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000024980
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-80
Family Sec7 domain 0.00000000964
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-34
Family Pleckstrin-homology domain (PH domain) 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000024980   Gene: ENSONIG00000019845   Transcript: ENSONIT00000025001
Sequence length 394
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:6804305:6837661:-1 gene:ENSONIG00000019845 transcript:ENSONIT00000025001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDNHVPEDLSVEERDELSNIRRRKRELLDDIERLKFEIAEVMTEIEQLTCVGESKTSQ
RNKQIAMGRKKFNMDPKKGIQFLLENDLLQHTPEDIAQFLYKGEGLNKTVIGDYLGERDD
FNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQ
STDTCYVLSFAIIMLNTSLHNPNVRDKPPVERFISMNRGINEGGDLPEELLRNLYDSIKN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPR
GIIPLENLSIREVDEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTP
EEKEEWIKSIKASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences I3KV34
XP_004562401.1.88231 XP_005448193.1.78416 XP_006801015.1.46954 ENSONIP00000024980 ENSONIP00000024980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]