SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025082 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025082
Domain Number 1 Region: 128-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-76
Family Nuclear receptor ligand-binding domain 0.00000000203
Further Details:      
 
Domain Number 2 Region: 76-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.39e-27
Family Nuclear receptor 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025082   Gene: ENSONIG00000019915   Transcript: ENSONIT00000025103
Sequence length 447
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:7437095:7541673:-1 gene:ENSONIG00000019915 transcript:ENSONIT00000025103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKGNPVPGPHLNGFPVPTYSYFFPHMLGSLSPPALPGLPLSGYSTPSPATIETQSTSS
EEIVPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREK
NCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKKKKDEKKQECTESYVLSPDTEQMI
DRVRKAHQDTFPSLCQLGKYTTTNSSERRVSLDVDLWDKFSELSTKCIIKTVEFAKQLPG
FTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRNQMHNAGFGPLTDL
VFAFANQLLPLEMDDAETGLLSAICLLCGDRQDLEEADKVDILQEPLLEALKIYVRKRRP
HKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLESGAAGGR
PSGAPPGSCSPSLSPSSAQSSPATQSP
Download sequence
Identical sequences I3KVD6
XP_004562456.1.88231 XP_004562457.1.88231 XP_004562458.1.88231 XP_004562459.1.88231 XP_004562460.1.88231 XP_004562461.1.88231 XP_005448236.1.78416 XP_005721686.1.53837 XP_005721687.1.53837 XP_005721688.1.53837 XP_005721689.1.53837 XP_005721690.1.53837 XP_005721691.1.53837 XP_005721692.1.53837 XP_005721693.1.53837 XP_005932851.1.24487 XP_006801063.1.46954 XP_006801064.1.46954 XP_014265247.1.88231 XP_019218294.1.78416 XP_019218295.1.78416 XP_019218296.1.78416 XP_019218297.1.78416 XP_019218298.1.78416 XP_019218299.1.78416 XP_019218300.1.78416 ENSONIP00000025082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]