SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025083 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025083
Domain Number 1 Region: 142-423
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-74
Family Nuclear receptor ligand-binding domain 0.0000000021
Further Details:      
 
Domain Number 2 Region: 90-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-27
Family Nuclear receptor 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025083   Gene: ENSONIG00000019915   Transcript: ENSONIT00000025104
Sequence length 462
Comment pep:known_by_projection scaffold:Orenil1.0:GL831136.1:7440941:7478615:-1 gene:ENSONIG00000019915 transcript:ENSONIT00000025104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVALLHMMYESVDVVGLNPSPNPFLMMDYYNQSRGCLIPEKGLVPGAPHPYSTSIRNQHW
NGSNHSIETQSTSSEEIVPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRR
SIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKKKKDEKKQEC
TESYVLSPDTEQMIDRVRKAHQDTFPSLCQLGKYTTTNSSERRVSLDVDLWDKFSELSTK
CIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNR
NQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGADRQDLEEADKVDILQE
PLLEALKIYVRKRRPHKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEM
LENSEGLESGAAGGRPSGAPPGSCSPSLSPSSAQSSPATQSP
Download sequence
Identical sequences I3KVD7
ENSONIP00000025083 ENSONIP00000025083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]