SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025193 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025193
Domain Number 1 Region: 178-446
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-83
Family Nuclear receptor ligand-binding domain 0.00000000247
Further Details:      
 
Domain Number 2 Region: 126-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025193   Gene: ENSONIG00000020007   Transcript: ENSONIT00000025214
Sequence length 452
Comment pep:known_by_projection scaffold:Orenil1.0:GL831408.1:485227:498955:1 gene:ENSONIG00000020007 transcript:ENSONIT00000025214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSCCLLSDSHSPDSSSVSSPPSGQRSPPLVPSAASMTSLPPITSAGVNSPISSIGSPFSV
ISSSLGSPCLPGTPSVGYGPISSPQINSTVSMSGLHAVSSSDDVKPPLGLKQLSSHSPGP
MLSQKRLCSICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCTVDKRQRNRC
QYCRYQKCLAMGMKREAVQEERQRNKDRDGEVESTSAVNEEMPVEKILEAEMAVEQKTEL
HADGSSGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLI
ASFSHRSISVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCL
RAIILFNPDAKGLSNPSEVELLRERVYASLEAYCKQKYPDQQGRFAKLLLRLPALRSIGL
KCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
Download sequence
Identical sequences I3KVP7
ENSONIP00000025193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]