SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025438 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025438
Domain Number 1 Region: 194-476
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-74
Family Nuclear receptor ligand-binding domain 0.00000000539
Further Details:      
 
Domain Number 2 Region: 144-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025438   Gene: ENSONIG00000020192   Transcript: ENSONIT00000025459
Sequence length 477
Comment pep:known_by_projection scaffold:Orenil1.0:GL831260.1:2096420:2130862:1 gene:ENSONIG00000020192 transcript:ENSONIT00000025459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAAVHRRYPDGISLRNRALLSNSLERFLSPLATLEPSHFWLLNRMAADDRHLPSSCGSYI
KTEPSSPSSVIDTVSHHSPSGNSDASGGYVSAMNSHSNGLDSPPMFTPSGLGAGTCRKRY
DDCSSTIMEDSSIKCEYMLNSLPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIE
YSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDTENNPY
LGLTLPPPTKKPLTKIVSHLLVAEPEKIYAMPDPTMPESDIKALTTLCDLADRELVVIIG
WAKHIPGFSTLSLGDQMSLLQSAWMEILILSIVFRSLPYEDELVYAEDYIMDEEHSRLTG
LLDLYVSILQLVRKYKKLKVEKEEFVTLKAIALANSDSMHIEDMEAVQKLQDALHEALQD
YESSQHQEDPRRAGKLLMTLPLLRQTATKAVQHFYSIKVQGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences I3KWE2
ENSONIP00000025438 ENSONIP00000025438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]