SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025471 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025471
Domain Number 1 Region: 125-136,251-468
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-50
Family Nuclear receptor ligand-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 53-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025471   Gene: ENSONIG00000020217   Transcript: ENSONIT00000025492
Sequence length 492
Comment pep:known_by_projection scaffold:Orenil1.0:GL831302.1:683733:810703:1 gene:ENSONIG00000020217 transcript:ENSONIT00000025492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIQKRTNGFDYPERNDAKPVNGFYSDHQLETEHNNSMDAVGENNLDDPTDQRTCLICGD
RATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCEMSRKQRNRCQYCRLLKCLQMGM
NRKAIREDGMPGGRNKSIGPVQITEEEIERIMSGQEFKEDAPEHTWGNNGDSDHSSPSNG
ASEGNQPSPASTLSSNRSAEMNGYTAALRDQYINTSMPTHYQLLPHLFSYAAQSGLLASQ
PRNLYPQSHPLVQQLVAAEELTPLTTPMLIEEEYKVTQVELFALLCRLADELLFRQISWI
KKLPFFCELSIEDYTCLLSSTWQELILLSCLTIYSGQIFGELADITAKYTPSDDELQGFS
EDGMEVMERLIILFRKLHHLKISNEEYACMKTINFLNQDIRGLSNISQLEQLNKRYWCVC
QDYIESKYPLQPKRFPEIMMCLPDIRCISTKLVNVPLEQLPLLFKAVLHSCKSSLTSYRT
GPSPCVTASTGN
Download sequence
Identical sequences I3KWH5
ENSONIP00000025471 ENSONIP00000025471 XP_005472950.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]