SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000025473 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000025473
Domain Number 1 Region: 116-127,238-501
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-61
Family Nuclear receptor ligand-binding domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 44-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000025473   Gene: ENSONIG00000020218   Transcript: ENSONIT00000025494
Sequence length 504
Comment pep:known scaffold:Orenil1.0:GL831302.1:868377:883446:1 gene:ENSONIG00000020218 transcript:ENSONIT00000025494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLPAVCCSNVGRQGSRSYQIHMKTNCQSVTLKVMEYTYDEDLEELCPVCGDKVSGYHYGL
LTCESCKGFFKRTVQNNKRYTCAENQECKIDKTQRKRCPFCRFQKCLNVGMRLEAVRADR
MRGGRNKFGPMYKRDRALKQQKKALIRSNGFKLESTAPPPASPLQADYGFTGTLHTLPTI
SKSLLPSTPSSITPTDYEANLYGPPSLGMAMQSHVPLTTQYQYTAFPGRAIKAECPDYTS
SPETLTGYPYPDMYPSASPQPPSLPPLVLELLRCDPDELVVQNKIVTHLQQEQNGRGRLE
KPSTFSLMCRMADQTLFSIVEWARSCIFFKELRVGDQMKLLHNCWSELLVLDHIFRQVQH
AKEDSILLVTGQEVELSSILSQAEGTLSSLVQRGQELAARLRVLQVDRREIACLKFLLLF
NPNVKLLENQAFVEGVQEQVNAALLEYTLSAYPQFQEKFSQLLVRLPELRSLSTQAEDYL
CYMHVSGEVPCNNLLIEMLHAKRA
Download sequence
Identical sequences I3KWH7
ENSONIP00000025473 ENSONIP00000025473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]