SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026247 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026247
Domain Number 1 Region: 143-238
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.44e-23
Family Elongation factor TFIIS domain 2 0.004
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.29e-16
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0024
Further Details:      
 
Domain Number 3 Region: 261-318
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000119
Family Transcriptional factor domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026247   Gene: ENSONIG00000020944   Transcript: ENSONIT00000026270
Sequence length 324
Comment pep:known_by_projection scaffold:Orenil1.0:GL831414.1:258461:259435:1 gene:ENSONIG00000020944 transcript:ENSONIT00000026270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMDPKEMLRCALQIEKFSADRSYGNIMTLLGDLQKSHVTAEQLETTDIVKVLYRLLKTCT
DDSVKKTVKSLLSEWKRQYTKDRQGVKCTEESEDPELPASVSSPKEAVGGAVSAQTCDGG
EGNAAGEPSSMQAKPGPKAHTSAASPDNVRTKCVQLLLAALCPSAPDQDKAAELARDIER
HVHELHNHNQVKYKACVRSKVANLRNPKSGHLHQGLLSGSLSPEAFARMSAEDMASAELR
QLREEYSSQGVSERQLPQGIEGTRTEKIRCKRCGGSDCRVTQVSRGVLFLPAWVRQGGPD
EDAMTFVTCSGCGQQWYHSSWVCL
Download sequence
Identical sequences I3KYQ0
ENSONIP00000026247 ENSONIP00000026247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]