SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000026342 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000026342
Domain Number 1 Region: 16-187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-45
Family G proteins 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000026342   Gene: ENSONIG00000021039   Transcript: ENSONIT00000026365
Sequence length 196
Comment pep:known_by_projection scaffold:Orenil1.0:GL831181.1:1353719:1354309:1 gene:ENSONIG00000021039 transcript:ENSONIT00000026365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADMGNSFSNLAAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTERIRLGGAG
ASRGISCHFWDVGGQEKLRPLWKPYSRCTDGIVYVVDSVDTERLEEARTELHKITRFAEN
QGTPLLVIANKQDLPRALDVGEIERQLALAELSPSTPYHVQPACAIIGEGLDEGMDKLYE
MIVKRRKSLKQKKKKQ
Download sequence
Identical sequences I3KYZ5
ENSONIP00000026342 ENSONIP00000026342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]