SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000290 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000290
Domain Number 1 Region: 169-374
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-52
Family DBL homology domain (DH-domain) 0.0000000527
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 379-542
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-30
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 632-758
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-24
Family SH2 domain 0.00061
Further Details:      
 
Domain Number 5 Region: 779-838
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-21
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 6 Region: 582-661
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000975
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000290   Gene: ENSONIG00000000226   Transcript: ENSONIT00000000289
Sequence length 844
Comment pep:known_by_projection scaffold:Orenil1.0:GL831395.1:758105:787745:1 gene:ENSONIG00000000226 transcript:ENSONIT00000000289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLIDCRVLPENHRVTLEGAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLGVCQDKFHLKKNELFEAFDLFDVRDFGKVIDTLSTLSHSSI
AVHRGFQPFPLEGCTLDEEIYSGLSDQIDDTVDEDDDLYDFVEDEENEGDEIYEDLMRAD
EPPETQQKTGVDKRECCLQEIRQTEEKYSETLQSILQHFMKPLQRFLQPQDIESIFINIQ
DLAKTHSELLEEVQNSILNNGARNLFQVFVNYKERLLLYGRYCSQVEAATKHLDKLSNAR
EDIRMKLEECSKRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDSTEKENLRTALD
AMRDLAQSVNEVKRDNEIIKQITTFQLSIENMTQSLALYGRPKIDGELKICSSEKRSKQD
RYAFLFDKAVFICKKKSGETFELKEIIELQSYQIRDETTGEKDNKKWSYLFLLLDCYGRS
GYDLFFKTRELKKKWLEQFEMALSNMSPENSTANNHDFQMYCFEETTSCKACSMLLRGIF
FQGYRCTRCKMAAHKECLGRVPACGRNSDHSVSAKKNKAQRSSGHSSIGYPKMEVNQEYY
GMPPPPVGFGQALNLSRGDVIELTRADAELPWWEGRNLTSGLMGWFPCQKVQPYLSRPTQ
DLSGFNWFAGNMDRTAAKNLLMSRSDGTFLVRQKDGGEYAISIKFNMDIRHIKITSSEGL
YRINDKKAFKGLIEMIQYYQQTSLKEYFKDLDTTLCIPFKQPEQSNLSDNMPNSTPGGSM
RNFGVARARYDFSARDRSELSLREGDTIKILSKKGHSGWWKGEVYGRVGFFPANYVEEDY
SDYC
Download sequence
Identical sequences I3IUK0
ENSONIP00000000290 XP_005462714.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]