SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000291 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000291
Domain Number 1 Region: 169-374
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.42e-52
Family DBL homology domain (DH-domain) 0.0000000527
Further Details:      
 
Domain Number 2 Region: 2-232
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 379-542
Classification Level Classification E-value
Superfamily PH domain-like 2.92e-30
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 639-765
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-24
Family SH2 domain 0.00061
Further Details:      
 
Domain Number 5 Region: 786-845
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-21
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 6 Region: 596-664
Classification Level Classification E-value
Superfamily SH3-domain 0.000000232
Family SH3-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000291   Gene: ENSONIG00000000226   Transcript: ENSONIT00000000290
Sequence length 851
Comment pep:known_by_projection scaffold:Orenil1.0:GL831395.1:767033:785840:1 gene:ENSONIG00000000226 transcript:ENSONIT00000000290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLIDCRVLPENHRVTLEGAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLGVCQDKFHLKKNELFEAFDLFDVRDFGKVIDTLSTLSHSSI
AVHRGFQPFPLEGCTLDEEIYSGLSDQIDDTVDEDDDLYDFVEDEENEGDEIYEDLMRAD
EPPETQQKTGVDKRECCLQEIRQTEEKYSETLQSILQHFMKPLQRFLQPQDIESIFINIQ
DLAKTHSELLEEVQNSILNNGARNLFQVFVNYKERLLLYGRYCSQVEAATKHLDKLSNAR
EDIRMKLEECSKRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDSTEKENLRTALD
AMRDLAQSVNEVKRDNEIIKQITTFQLSIENMTQSLALYGRPKIDGELKICSSEKRSKQD
RYAFLFDKAVFICKKKSGETFELKEIIELQSYQIRDETTGEKDNKKWSYLFLLLDCYGRS
GYDLFFKTRELKKKWLEQFEMALSNMSPENSTANNHDFQMYCFEETTSCKACSMLLRGIF
FQGYRCTRCKMAAHKECLGRVPACGRNSGQDFQVLRSKEEQSRDRQTQNENEWGGGYPKM
EVNQEYYGMPPPPVGFGQALNLSRGDVIELTRADAELPWWEGRNLTSGLMGWFPCQKVQP
YLSRPTQDLSGFNWFAGNMDRTAAKNLLMSRSDGTFLVRQKDGGEYAISIKFNMDIRHIK
ITSSEGLYRINDKKAFKGLIEMIQYYQQTSLKEYFKDLDTTLCIPFKQPEQSNLSDNMPN
STPGGSMRNFGVARARYDFSARDRSELSLREGDTIKILSKKGHSGWWKGEVYGRVGFFPA
NYVEEDYSDYC
Download sequence
Identical sequences I3IUK1
ENSONIP00000000291 ENSONIP00000000291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]