SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000402 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000402
Domain Number 1 Region: 338-521
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-60
Family SPRY domain 0.000019
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-17
Family RING finger domain, C3HC4 0.0089
Further Details:      
 
Domain Number 3 Region: 122-183
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000402   Gene: ENSONIG00000000318   Transcript: ENSONIT00000000401
Sequence length 527
Comment pep:novel scaffold:Orenil1.0:GL831457.1:372549:379667:1 gene:ENSONIG00000000318 transcript:ENSONIT00000000401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVMASNMLPEKQFYCPVCEQVFTDPVTTPCGHNFCQTCIQSKWEGTDICQCPACDRSFPS
RPEISINIAFKELADTFKQMIVCSSAAPLSSAQPGEVVCDVCAAESHLEPHKRVVTLKLH
KLMEPVKNLQDRMCKKHERLLEMFCRDEQKCVCQFCTETEHRDHKVVSVEDESTERKVLI
KKSEADFQQMIQERLKKVEEIKNCLKLSTVSGEMEVKESDRLFTSLIHTIKERQTEVNAE
IKEKQKAVERRAEELISDLQQEITELQRRNTEMEELKNTEDHLHLLQHLPSITSPPPTKE
WMEINIPPELCVGTVRRALSKVERTLMNDMDNLKKEEMKRMQKYAVDVVLDPDTAHPNIV
LTADGKQAGRGELLHVVPDNPQRFDPVICVLAKQGYISGRFYFQVLVGQKTFWDLGVVKG
SVNRKGMITSKPENGYWTVRLRNGDEYRALDSPSVRLPLKEKPEIVGVFTDYDEGTVSFF
DVEARSHIYTFTGCLFSEKVYPFFSPGVCDEGKNKGPLIITTVNQES
Download sequence
Identical sequences I3IUW2
ENSONIP00000000402 ENSONIP00000000402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]