SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000528 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000528
Domain Number 1 Region: 361-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-63
Family SPRY domain 0.0000107
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 9.98e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Domain Number 3 Region: 146-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000321
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000528   Gene: ENSONIG00000000415   Transcript: ENSONIT00000000527
Sequence length 546
Comment pep:novel scaffold:Orenil1.0:GL831375.1:140334:159099:-1 gene:ENSONIG00000000415 transcript:ENSONIT00000000527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYDSFLCEEQFQCSICLDVFTNPASTPCGHSFCMQCITKYWNGAKVFKCPLCKKSFEK
RPDLQINRTLREITDQYKSMKNGVVKNKSGRKGSGGHGSPSSHLFDELKKKLRHPVRKTH
QTFSRSPPVSHRPHTWRRRYTLSGTEMSQNVPLCEIHNRPILIFCRSDQVCICPECEMED
HPDHDTVTVETEWMETKTLLTVSERTIQDMIIERINKIEEINMSVTELELAVDRETAGSV
SLFSSLVCFIERSQAELVEAMEISRKAAQRHAESMTRQLEQEIEELKKRQSELSKLAQSD
DHLYCVKTFPILSSPPPTKDWYKVSVNSDLGTESIYMSILAQVEKFAKELKNITEKGIKG
IQEYALDVTLDSNTAHPRLVLSSDLKSVRCGDRHQLVPDNPERFEKVVCVIGREPISSGK
HYWEVDVTGKTDWDLGVVKYSVSRKGKIEYTPDNGFWFLSLRDKNKFGFRSQPYTDVPVN
LVLHKIGIFVDFENGQVSFYNVDAKIHIYTFNDIFNETLYPFFSPCTNKSGRNDLPLIIT
PVKMTE
Download sequence
Identical sequences I3IV88
ENSONIP00000000528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]