SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000735 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000735
Domain Number 1 Region: 293-353
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000124
Family UBA domain 0.0095
Further Details:      
 
Domain Number 2 Region: 18-197
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000275
Family Rhomboid-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000735   Gene: ENSONIG00000000579   Transcript: ENSONIT00000000734
Sequence length 353
Comment pep:known_by_projection scaffold:Orenil1.0:GL831135.1:2327082:2335822:1 gene:ENSONIG00000000579 transcript:ENSONIT00000000734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTTTGSRGLYKAPLSKSLLLVLNGLTVMLTLLPRYQDLFVYHLQAITQEHQVWRLLCGR
LVCLDIKDSFCSSLLIYNFRIFERRFGTRKFASFLFGTWCLSALMDFLLAKAFQFLFDYE
LEELPSGLLAPVFSLFVPFYLSIPRMPVTQVLGRIHITNKSLVYIVGLQLLTSSPFMWLL
ALSGLISGGLYHSSVLRLQKILFVPAWVSRIGQYILEPVFSSSQPTSETPLGMGATLDVQ
RQQRMELLDQQLLLAQYNEARRNARQQPQSGLLQWTRLFPSLRHRGQNRVPVQPRPQPQE
HQSTQPPSLDNSPVAEEQVARLVEMGFSRIDALEALRASNNDINMATNFLLQH
Download sequence
Identical sequences I3IVU5
ENSONIP00000000735 XP_003438338.1.78416 ENSONIP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]