SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000000789 from Oreochromis niloticus 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000000789
Domain Number 1 Region: 127-204
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.57e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 876-938
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000506
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 3 Region: 282-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 4 Region: 78-127
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000000789   Gene: ENSONIG00000000620   Transcript: ENSONIT00000000788
Sequence length 973
Comment pep:known_by_projection scaffold:Orenil1.0:GL831135.1:2550589:2604873:-1 gene:ENSONIG00000000620 transcript:ENSONIT00000000788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQCDALSGYLQQSDQGSNSERSTDSPLPGSEEDLSGPHSLPDPEWTEERFRVDRKKLE
VMLLAASEGRVNGGEDFFQKIMDETQTQIAWPSKLKIGAKSKKDPHIKVCGKRENVREAK
DRIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKRVMEETGCHIHFPDSNRNNQAEK
SNQVSIAGQPGGVEAARVKIRELLPLVLSFELPAIMQSDPSSPTVQHISQTYNLTVSFKP
PTRLYRATGVVRGSQNNANAVKRGTALLLEHLAGSLASTISVTTHLDIAPQHHLFMKGRN
GSNIKHITQRTGAQIHFPDPNSPQKKSTVYIQGTIESVCLARQYLMGCLPLVLMFDIKED
IEVEPQCITALMEQLDVFISIKPKPKQPSKSVIVKSVERNAVNMYEARKFLLGLESNGVV
SSSPPVALNPSTNGPSPSLICPVGLDILASAGLGLSNLGFLGATASHSLPNSAAPNAVLN
SLNSSMSPLQTPSPSNPTPSASLWPSSLTSTQEGFSSQLMLHPATQATLSSILLSGVPGY
TPNTPSPPPGLAPIDKQPNGVPECTLNGHVKHSGSVYGRITTASIAENVLSPAPCDSVQE
ASGHSPSEPRSSKSSPDEGSDTFVEVGMPRSPSHSANGNELKQMLASCKTSSGKRQAVEL
LQGTKNSHLHSSDCLLSDTESSSSDSPVADKRAPGSERAAERAAQQNERERANMEREAMV
LLALAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVSY
KPSMSTTYEGSPLPLSRSSSREGVGNGSDSDNWRERNGTSNGLASHTEFASAVSSPKRKQ
NKSAAEHYLSSSNYMDSISSVTGSNGCSLNSSLKGSDLPELFSKLGLGKYTDVFQQQEID
LQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFEPPIRSSFLEGGASGRLSR
QFHAEMASVSGRW
Download sequence
Identical sequences I3IVZ9
ENSONIP00000000789 ENSONIP00000000789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]